PNC-27

PNC-27 is a 32-amino-acid chimeric peptide built by fusing residues 12–26 of the human p53 tumor-suppressor protein — the segment carrying the HDM-2 (MDM2) binding domain — to a C-terminal membrane-residency, cell-penetrating sequence. Its sequence is PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG, in which the first fifteen residues reproduce the p53 transactivation-domain helix and the remaining seventeen supply the amphipathic, membrane-active leader. That dual-domain architecture is what makes PNC-27 a distinctive laboratory probe: it is studied in preclinical oncology research as a tool for interrogating the p53–HDM-2 protein–protein interaction and membrane-pore formation in transformed cell lines, rather than as a conventional intracellular pathway inhibitor. It should not be confused with the related construct PNC-28, which carries the shorter p53 17–26 segment. This material is supplied for research use only and is not for human consumption.

In published preclinical work, PNC-27 has been characterized as a membrane-active peptide whose two domains contribute distinct functions. NMR studies report that it adopts amphipathic helix-loop-helix conformations in both aqueous and membrane-mimetic solvents, segregating hydrophobic and polar residues onto opposite faces. The p53 12–26 segment has been shown to adopt a conformation superimposable on the same residues bound to HDM-2, and colocalization and antibody-blocking experiments in cultured cells indicate that PNC-27 associates with HDM-2 present in the plasma membrane of cancer-derived cell lines but largely absent from the membranes of untransformed control lines. Immuno-electron microscopy has resolved PNC-27–HDM-2 complexes arranged in ring-like structures at pore sites, supporting a model in which engagement of membrane-bound HDM-2 nucleates transmembrane pore formation and rapid, necrosis-like loss of membrane integrity in susceptible in-vitro models.

Solution Structure and Amphipathic Character

Rosal et al. (2004) applied two-dimensional NMR to the 32-residue PNC-27 sequence in both an aqueous, cytosolic-like environment and a membrane-mimetic organic solvent. They reported three alpha-helical domains joined by loop structures in water, lengthening into a U-shaped helix-coil-helix ensemble under membrane-mimetic conditions, with hydrophobic residues coalescing on one face and polar residues on the opposite face — an amphipathic arrangement the authors linked to the peptide’s membrane-disruptive behavior in cultured cell lines [1].

Membrane-Bound HDM-2 as the Binding Partner

Sarafraz-Yazdi et al. (2010) found that the three-dimensional structure of the p53 residues within PNC-27 is directly superimposable on the same residues bound to HDM-2. They detected significant HDM-2 in the membranes of a range of cancer-derived cell lines but not in several untransformed lines, showed colocalization of PNC-27 with membrane-bound HDM-2, and reported that transfecting untransformed MCF-10-2A cells with a membrane-localized full-length HDM-2 construct rendered those previously unaffected cells susceptible to the peptide [2].

Pore Architecture by Immuno-Electron Microscopy

Sarafraz-Yazdi et al. (2022) combined conformational energy calculations with immuno-scanning electron microscopy using differently sized gold-labeled anti-PNC-27 and anti-HDM-2 antibodies. The calculations predicted 1:1 PNC-27–HDM-2 complexes with the leader sequence oriented away from the interface, and the microscopy resolved the two gold labels in approximately 1:1 ratios within layered ring-shaped structures at pore sites near the cell surface. No pores were observed in the PNC-27-treated untransformed fibroblast controls [3].