Free Shipping on Orders Over $200
The Purest Peptides. Period.
Lab Tested and Shipped from the USA

LL-37

$150.00

Quantity
Discounted Price
5–9
$141.00 each (save $9.00/unit)
10+
$135.00 each (save $15.00/unit)

Quantity

For Research Use Only
Compound Overview
Class Peptide
Also Known As Cathelicidin, hCAP18 (134-170), Human Cathelicidin Antimicrobial Peptide
CAS Number 154947-66-7
Molecular Formula C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight 4,493.33 g/mol
Purity ≥99%
Amino Acid Sequence [LL-37, 37 aa]
Research Areas
Antimicrobial peptides Innate immunity Biofilm biology Immunomodulation

What is LL-37?

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino acid alpha-helical peptide derived from the C-terminal cleavage of the hCAP18 precursor protein. It is produced by neutrophils, macrophages, epithelial cells, and other cell types as part of the innate immune defense system. LL-37 was first isolated and characterized in the late 1990s and has since become one of the most extensively studied host defense peptides in innate immunology research. The peptide derives its name from the two N-terminal leucine residues (“LL”) and its 37-amino acid length. LL-37 has broad-spectrum antimicrobial activity against gram-positive and gram-negative bacteria, fungi, and enveloped viruses. Beyond direct antimicrobial activity, LL-37 functions as an immunomodulatory peptide, influencing chemotaxis, cytokine production, angiogenesis, and wound biology. Its expression is regulated by vitamin D signaling through the VDR/RXR response element in the CAMP gene promoter.

Mechanism of Action

LL-37 has been investigated for its dual antimicrobial and immunomodulatory mechanisms. As an amphipathic alpha-helical peptide, LL-37 inserts into bacterial membranes through electrostatic interactions with anionic lipopolysaccharides (gram-negative) or lipoteichoic acids (gram-positive), forming pores or disrupting membrane integrity. Researchers observed that LL-37 is also effective against biofilms, disrupting the extracellular polymeric matrix and preventing biofilm formation at sub-bactericidal concentrations. Beyond direct antimicrobial activity, LL-37 has been investigated for its immunomodulatory functions: it acts as a chemoattractant for neutrophils, monocytes, and T cells through FPR2/ALX receptor activation; modulates TLR signaling by binding and neutralizing LPS and lipoteichoic acid; and influences dendritic cell differentiation and macrophage polarization. Studies suggest that LL-37 also promotes angiogenesis through VEGF-independent pathways and stimulates keratinocyte migration in wound models.

Published Research

Antimicrobial Activity

Dürr et al. (2006) reviewed LL-37’s antimicrobial spectrum and membrane-disrupting mechanism, characterizing its activity against a broad range of pathogens and its selectivity for microbial versus mammalian membranes [1].

Biofilm Disruption

Overhage et al. (2008) investigated LL-37’s anti-biofilm properties against Pseudomonas aeruginosa. Researchers observed that LL-37 at sub-inhibitory concentrations reduced biofilm formation, stimulated bacterial motility, and downregulated biofilm-related genes [2].

Immunomodulation

Vandamme et al. (2012) reviewed LL-37’s immunomodulatory functions, describing its effects on chemotaxis, cytokine modulation, TLR signaling, and adaptive immune cell regulation beyond its direct antimicrobial activity [3].

Product Specifications

Product LL-37 Lyophilized Powder
Available Sizes 10mg
Purity ≥99% (HPLC verified)
CAS Number 154947-66-7
Sequence [LL-37, 37 aa]
Molecular Formula C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight 4,493.33 g/mol
Appearance White lyophilized powder in glass vial
Storage Store lyophilized at -20°C. Reconstituted solution at 2-8°C, use within 7 days.
Testing Third-party tested — Certificate of Analysis available

Frequently Asked Questions

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino acid host defense peptide with both direct antimicrobial and immunomodulatory functions.

The CAS registry number for LL-37 is 154947-66-7.

LL-37 is an amphipathic alpha-helical peptide that inserts into bacterial membranes through electrostatic interactions, forming pores that disrupt membrane integrity.

Store lyophilized LL-37 at -20°C. Once reconstituted, store at 2-8°C and use within 7 days due to its susceptibility to proteolytic degradation.

No, LL-37 has extensive immunomodulatory functions including chemotaxis, cytokine modulation, TLR signaling regulation, angiogenesis, and effects on wound biology.

LL-37 expression is regulated by vitamin D signaling through a VDR/RXR response element in the CAMP gene promoter, linking vitamin D status to innate immune defense.

References

  1. Dürr UH, et al. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochim Biophys Acta. 2006;1758(9):1408-1425. PMID: 16716248
  2. Overhage J, et al. Human host defense peptide LL-37 prevents bacterial biofilm formation. Infect Immun. 2008;76(9):4176-4182. PMID: 18591225
  3. Vandamme D, et al. A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cell Immunol. 2012;280(1):22-35. PMID: 23246832

Customer Reviews

4.8
Based on 5 reviews
A
Amanda P. Verified Mar 3, 2026

Consistent quality across multiple orders. Very satisfied.

A
Anthony P. Verified Jan 23, 2026

Really happy with this. Clean, pure, well-packaged.

A
Alex W. Verified Jan 15, 2026

This vendor sets the standard. Highly recommend.

T
Taylor C. Verified Jan 12, 2026

Great product. Arrived quickly and exactly as described.

J
Jordan W. Verified Dec 2, 2025

Good product overall. Shipping took a couple extra days.

LL-37
You're viewing: LL-37 $150.00
Select options
Your Cart

Your cart is empty

Browse Products

Product Index